HORDB

ID: hor006355
Uniprot ID: O12956
Protein name: Glucagon-like peptide 2
Gene name: GCG
Organism: Heloderma suspectum (Gila monster)
Family: Glucagon family
Source: animal
Expression: Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.|Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in saliv
Disease: NA
Comments: NA
Taxonomy: Heloderma (genus), Helodermatidae (family), Neoanguimorpha , Anguimorpha (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region

Sequence: HADGTFTSDYNQLLDDIATQEFLKWLINQKVTQ
Length: 33(164-196)
Propeptide: MTSMYFVAGLLLMIVQGSWQSPLQETEEKSRSFKASQAEPLDDSRQLNEVKRHSQGTFTSDYSKYLDTRRAQDFVQWLMNTKRSGQQGVEEREKENLLDQLSSNGLARHHAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRGRRDFLEEAGTADDIGRRHADGTFTSDYNQLLDDIATQEFLKWLINQKVTQRDLLGEYQ
Signal peptide: MTSMYFVAGLLLMIVQGSWQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006355_AF2.pdb

hor006355_ESM.pdb

Mass:	442524	Formula:	C173H262N44O56
Absent amino acids:	CMPR	Common amino acids:	DLQT
pI:	4.19	Basic residues:	3
Polar residues:	9	Hydrophobic residues:	12
Hydrophobicity:	-54.85	Boman Index:	-6030
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	85.76
Instability Index:	100.91	Extinction Coefficient cystines:	6990
Absorbance 280nm:	218.44

PubMed ID: 9020121
Title: Tissue-specific expression of unique mRNAs that encode proglucagon-derived peptides or exendin 4 in the lizard.
PubMed ID: 9545315
Title: Molecular cloning of the helodermin and exendin-4 cDNAs in the lizard. Relationship to vasoactive intestinal polypeptide/pituitary adenylate c
PubMed ID: 12554744
Title:
PubMed ID: 12626323
Title:
PubMed ID: 10322410
Title:
PubMed ID: 10605628
Title: